SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019260 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019260
Domain Number 1 Region: 439-696
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-49
Family YWTD domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000929
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 3 Region: 230-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 4 Region: 145-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 268-308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 183-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 8 Region: 103-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 9 Region: 356-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 392-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 11 Region: 314-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 12 Region: 700-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019260   Gene: ENSPANG00000025120   Transcript: ENSPANT00000025213
Sequence length 869
Comment pep:known_by_projection chromosome:PapAnu2.0:15:72577525:72596617:-1 gene:ENSPANG00000025120 transcript:ENSPANT00000025213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APCGLWAIWIVSILVWFHLPEITRRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDE
KNCVKKTCAESDFVCNNGQCVPNRWKCDGDPDCEDGSDESPEQCHMRTCRINEISCAAHS
TQCIPVSWRCDGENDCDSGEDEENCGNITCSPSEFTCSSGRCISRNFVCNGQDDCSDGSD
ELDCAPPTCGVHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEI
QCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCV
DGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNN
GGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRG
YQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLF
WADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDG
TKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQWPNG
ITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGEN
EAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQ
INDHSPKYTCSCPNGFNLEENGRDCQSTATTVTYSETKDTNTTEISPTSGLVPGGINVTT
AVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEED
LSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences ENSPANP00000019260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]