SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019271 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019271
Domain Number 1 Region: 22-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 8.17e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019271   Gene: ENSPANG00000025113   Transcript: ENSPANT00000025379
Sequence length 540
Comment pep:known_by_projection chromosome:PapAnu2.0:15:75521474:75832112:1 gene:ENSPANG00000025113 transcript:ENSPANT00000025379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETSQNVPDAKRPGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTTEPNTLEVQDDNASVLDVYL
Download sequence
Identical sequences A0A096P1P6 A0A2K5WNX0 F7FF50
XP_005581929.1.63531 XP_005581930.1.63531 XP_007967615.1.81039 XP_007967616.1.81039 XP_014973338.1.72884 XP_014973339.1.72884 ENSPANP00000019271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]