SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019276 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019276
Domain Number 1 Region: 453-617
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 631-754
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 746-830
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-16
Family PDZ domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019276   Gene: ENSPANG00000025107   Transcript: ENSPANT00000025481
Sequence length 837
Comment pep:known_by_projection chromosome:PapAnu2.0:15:76241681:76307897:-1 gene:ENSPANG00000025107 transcript:ENSPANT00000025481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPDVEEEQQQPPQQQHYAGRHQRGGALEDL
RAQLGQEEEERGECLERSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAV
QYRPEAEEYTEQAEAEHAEATHRPALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGED
EPYAEPYADYGGLQEHVYEEIGDAPELDAHDGLRLYEQEPDEAAAYRQEALGARLHHYDE
RSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDL
ERPPTPTGGRPDSPGLQAPAGQQRATGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEV
KTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGDSPSPGSSSPLGAESSGTPLH
PSDPAEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKN
VRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDH
PLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLI
AQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIE
KQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLS
TCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERG
GVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEVVITTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences ENSPANP00000019276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]