SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019328 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019328
Domain Number 1 Region: 539-714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.73e-51
Family G proteins 0.000015
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000885
Family Polcalcin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019328   Gene: ENSPANG00000024899   Transcript: ENSPANT00000025075
Sequence length 740
Comment pep:known_by_projection chromosome:PapAnu2.0:15:89621675:89694440:-1 gene:ENSPANG00000024899 transcript:ENSPANT00000025075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADGDGEQLARLRSVFAACDANRSGRLEREEFGSLCAELRVRPADAEAVFQRLDADHDG
AITFQEFARGFRGALRGGRREDRGLLGPAPAVAEAGPETPDSEEDEGDEDAEAALATSWG
PASPDPAWQDFQARLGEEAKFIPREEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIRLQ
STEMENLAIAVKRAQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYE
TEVGDLQVTIKKLRKLEEQSKHISQKEDVAALKKQIYDLSMENQKVKKELLEAQTNIAFL
QSELDALKSDYADQSLNTERDLEIIRGYTEDRNSLERQIEILQTANRKLHDSNDGLRSAL
ENSYSKFNRSLRINNISPGNTISRSSPKFTGHSPQPLGYDRSSRSSYVDEDCDSLALCDP
LQRTNCEVDSLPESCFDSGLSTLRDPNEYDSEVEYKHQRGFQRPHGVQESFGGDASDTDV
PDIRDEETFGLEDVASISDWKLQGTVSEGSIVSSSRKPISALSPQTDLVDDNAKSFSTQK
AYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQ
ERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADVRD
TAAAGGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKDDSKSI
TNLTGTNSKKSPQMKNCCNG
Download sequence
Identical sequences A0A096P1V3
ENSPANP00000019328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]