SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019354 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019354
Domain Number 1 Region: 110-292
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000176
Further Details:      
 
Domain Number 2 Region: 458-569
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-27
Family SH2 domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019354   Gene: ENSPANG00000024872   Transcript: ENSPANT00000024818
Sequence length 576
Comment pep:known_by_projection chromosome:PapAnu2.0:15:95323751:95485292:-1 gene:ENSPANG00000024872 transcript:ENSPANT00000024818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCTAMSTARKGRPGDEPLPRPP
RGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGA
FKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSISFASG
GDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFKQYLQCPTKIPAL
HDRMQSLDEPWTEEEGEGSDHPYYNSIPSKMPPPGGFLDARLKPRPHAPDTAQFAGKEQT
YYQGRHLGDTFGEDWQQTPFRQRSLEIYSMPEGKLHVAPTGEAPTYVNTQQIPPQAWPTA
VSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISPVSPRAPDAKMLEDLQAET
WYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDR
VFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
Download sequence
Identical sequences ENSPANP00000019354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]