SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019366 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019366
Domain Number 1 Region: 48-393
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.86e-90
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019366   Gene: ENSPANG00000024839   Transcript: ENSPANT00000024765
Sequence length 394
Comment pep:known_by_projection chromosome:PapAnu2.0:15:96647985:96657297:1 gene:ENSPANG00000024839 transcript:ENSPANT00000024765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQ
AGLWAATQVSMDHPPTGPPSQDDFSEVLTQVHEGFEVGTLAGPAFAWLRRSLGLAEDDYQ
AALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQTLLAHLPRYVQHLQRHPHS
LLARLLGVHSLRVDRGKKTYFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPIVL
VLKDLNFQGKTIKLGPQRNWFLRQMELDTTFLRELNVLDYSLLMAFQCLHEDERGLGSSL
IFRTARSVQGAQSPEESGVQNRRLLPDAPNALHILDGPEQRYFLGVVDLATVYGLRKRLE
HLWKTLRYPGRTFSTVSPARYARRLCQWVEEHTE
Download sequence
Identical sequences A0A096P1Z1
ENSPANP00000019366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]