SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019373 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019373
Domain Number 1 Region: 207-324
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 569-725
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-22
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019373   Gene: ENSPANG00000024834   Transcript: ENSPANT00000024714
Sequence length 845
Comment pep:known_by_projection chromosome:PapAnu2.0:15:96785877:96827365:1 gene:ENSPANG00000024834 transcript:ENSPANT00000024714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGTKKTSKKFKFFKFKGFGSLSNLPRSFTLRRSLAPISRQSHLEPDIFEATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRPSIKKAQNSQAVRQAQEVGPKPNLVPRGVPDPPGLEAA
KEVMVKANGPLEDIPAVEPNPSAVEVDPIRKPEVPTGDTEEERPPRDVHSESFSSSPPRN
GSQYLKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGD
FLIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRY
HVGSRKAVSEQSGAIIYCPVNRTFPLRYLEASYGLGQGSSKPASPVSPSGPKGSHMKRRS
VTMTDGLTADKVTRSDGCPTSTSLPRPRDSIRSCALSMDQIPDLHSPMSPISESPSSPAY
STVTRVHAAPAAPSATALPASPVTRRSSEPQLCPGSAPKTHGESDKGPHTSPSHTLCKTS
PSPSLSSYSDPDSGHYCQLQPPVRGSREWAAAEASSRQARSYGEKLKELSENGAPEEDWG
KTFTVPIVEVTSSFNPATFQSLLIPRDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDC
LVARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAE
ERAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQISRLEQTWVALRQRHTEGAILYE
KKLKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPPEGPEPWGSTEHGVEVVLAH
LEAARTVAHHGGLYNTNAEVKLQGEWRVASSGACRPGPPSTCLTVSLSSKASIHISALLC
PALSP
Download sequence
Identical sequences ENSPANP00000019373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]