SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019375 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019375
Domain Number 1 Region: 58-320
Classification Level Classification E-value
Superfamily TPR-like 2.88e-19
Family Tetratricopeptide repeat (TPR) 0.0086
Further Details:      
 
Domain Number 2 Region: 332-473
Classification Level Classification E-value
Superfamily TPR-like 2.84e-18
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019375   Gene: ENSPANG00000024831   Transcript: ENSPANT00000024716
Sequence length 860
Comment pep:known_by_projection chromosome:PapAnu2.0:15:96834842:96851068:-1 gene:ENSPANG00000024831 transcript:ENSPANT00000024716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSDEDALKVDQGPSQDIPKPWVIPAPKGILQHIFGTSQVFQSICDVKPKVTGLTVPLK
VREYYSRGQQCLEQADWETAVLFFSRALHLDPQLVDFYALRAEAYLQLCDFSSAAQNLRR
AYSLQQDNYKHLKRLTFVLYLQGQCLFEQCAFLDALNVFSHAAELQPEKACFRYRCMACL
LALKQHPACLSLITEELKQDTTNADVYILRARLYNFLQKTQLSHYRDLHGALLLNPKHPQ
ARMLLQKMVQAQQARQDAGILAVQGRLQHALQRINCAIENNPLDPSLFLFRGTMYRRLQE
FDGAVEDFLKVLDMVTEDQEDMVRQAQRQLLLTYNDFAVHCYRQGAYQEGVLLLNKALRD
EQQEKGLYINRGDCFFQLGYLAFAEADYQQALALSPQDEGANTRMGLLQEKMGFCEQKHR
QFQKAEDHFSTAIRHNPQKAQYYLYRAKSRQLLQNIFGARQDVATVLLLNPKQPKLSLLM
TNLFPGMSVEEVLSTQIAHLARLQLERTVEGSLQAGGPQGIVGMLKQWELERQKALALQL
SWKQEEPLIETSEKLQATPEIPQVEPGSSEGQAEAPWSTRQGPKPLGQEKKPKLTPSKVA
SLSESYLDQTSLASSMSFRTTCTSETETSAICQEYRSTSATAMTFSDSSLLKTQSSDSGN
NREALSHGPRKIKDIQGQRQSLSKTQATQSQRQNFSKTKAAVHRRNSSKTQATQGQGQRS
SKTEATQGQRQSSSETETSQGPRQEPSKTKTTRSPRQRPRKVKAARGRSWRPSKLDATQG
RSRGLLRSSTKTEAFYDSNWSLSKTEDVQGQGQRTSKAEAAQGKSQGMSSTSSKAESTWG
PSPSVSKTEVGQDLTYYEAL
Download sequence
Identical sequences ENSPANP00000019375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]