SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019386 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019386
Domain Number 1 Region: 14-305
Classification Level Classification E-value
Superfamily Ras GEF 9.29e-80
Family Ras GEF 0.0000357
Further Details:      
 
Domain Number 2 Region: 453-578
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019386   Gene: ENSPANG00000024825   Transcript: ENSPANT00000024585
Sequence length 585
Comment pep:known_by_projection chromosome:PapAnu2.0:15:97360695:97622202:-1 gene:ENSPANG00000024825 transcript:ENSPANT00000024585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSGTARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESRGRL
YATLGPNWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPAL
SSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQL
NNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences A0A2K5L1N5 A0A2K5XTN0
XP_011843880.1.47321 XP_011894508.1.92194 ENSPANP00000019386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]