SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019390 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019390
Domain Number 1 Region: 82-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000286
Family LIM domain 0.012
Further Details:      
 
Domain Number 2 Region: 206-269
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000124
Family Homeodomain 0.0077
Further Details:      
 
Domain Number 3 Region: 52-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000127
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019390
Domain Number - Region: 143-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.035
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019390   Gene: ENSPANG00000024818   Transcript: ENSPANT00000024589
Sequence length 395
Comment pep:known_by_projection chromosome:PapAnu2.0:15:97888023:97969397:-1 gene:ENSPANG00000024818 transcript:ENSPANT00000024589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQ
RPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCME
KIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVS
PDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTTAAPGWPDLIPLSLGQ
VRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSSRMEGMMA
SYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSIFHDIDSDTSLTS
LSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
Download sequence
Identical sequences ENSPANP00000019390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]