SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019402 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019402
Domain Number 1 Region: 12-104
Classification Level Classification E-value
Superfamily EF-hand 1.34e-22
Family S100 proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019402   Gene: ENSPANG00000024809   Transcript: ENSPANT00000024566
Sequence length 108
Comment pep:known_by_projection scaffold:PapAnu2.0:JH685365.1:4891:6117:-1 gene:ENSPANG00000024809 transcript:ENSPANT00000024566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGFLKAKMSIPPPEKVMLDIVAMFHQYSGDDGTIDMPGLVNLMKENFPNFLRGCEKSDTD
YLSTAFEKKDENKDKKINYSEFLSLLGDVAIDYHKIMHGVVLCFGGSQ
Download sequence
Identical sequences ENSPANP00000019402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]