SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019405 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019405
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.2e-66
Family Eukaryotic proteases 0.0000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019405   Gene: ENSPANG00000024801   Transcript: ENSPANT00000024613
Sequence length 305
Comment pep:novel chromosome:PapAnu2.0:15:101590836:101602880:-1 gene:ENSPANG00000024801 transcript:ENSPANT00000024613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTVCGKPKVVGKIYGGQDAAAGQWPWQASLLYRSSHLCGAVLIDSRWLVSTAHCFLNKS
QAPENYQVLLGNTQLYHQTQHTQKMSVHQIITHPDFEKLHPFGSDIAMLQLHLPVNFTSY
IVPACLPSQDMQLPSNVSCWITGWGMLTEDLQLSPPFYLQEGKVGLIENALCNTLYGQRT
GQGETYAVHEEMLCVGDFSTGKSICKGTMSGPSLLDLTEWVLFPTFSVSLXCWHPAYPSI
FTRVTYFTNWIDEVMRLTPLPDPTLAPHTRSPPKPLRAAGLPGPCAALVLPQTWLLLPLT
LRAPW
Download sequence
Identical sequences ENSPANP00000019405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]