SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019418 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019418
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019418
Domain Number - Region: 87-145
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0915
Family Rhodopsin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019418   Gene: ENSPANG00000024696   Transcript: ENSPANT00000024469
Sequence length 255
Comment pep:known_by_projection chromosome:PapAnu2.0:15:102315139:102341189:1 gene:ENSPANG00000024696 transcript:ENSPANT00000024469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAATLRGKARPRGRAGVTTPAPGNRTGTCAQLRLPPQATFQVLRGDGASVGTVLMFH
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFRVAVIASIVSCAIILLMS
MAFLTCCLLKCMKKSEQRRSDRSAQLWSQLRDEDLETVQAAYLGLKHFNKPVSRSSQAHD
NHSFTTDHVESTSKLASVTCSVDKDPRIPRALSLSGSSSSPQAQVMVHMANPRQPLPASG
LATGMPQKPAAYALG
Download sequence
Identical sequences ENSPANP00000019418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]