SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019443 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019443
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019443
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0199
Family Classic zinc finger, C2H2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019443   Gene: ENSPANG00000024635   Transcript: ENSPANT00000024361
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:15:105535740:105548558:-1 gene:ENSPANG00000024635 transcript:ENSPANT00000024361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNCINVYKNYQQDGIRRGRPRADTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRT
HTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTHANRHCPKHPY
ARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLKGKLVQKADQEQQDPLEYL
QSDEEDDEKRGAQRRLQEQRERLHGALALIELANLTGAPLRQ
Download sequence
Identical sequences ENSPANP00000019443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]