SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019451 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019451
Domain Number 1 Region: 23-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-36
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 2 Region: 656-832
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-35
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 3 Region: 208-382
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-32
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 842-1046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-29
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 5 Region: 450-508
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000201
Family Fibrinogen C-terminal domain-like 0.0036
Further Details:      
 
Domain Number 6 Region: 423-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000384
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019451   Gene: ENSPANG00000024642   Transcript: ENSPANT00000024231
Sequence length 1161
Comment pep:novel chromosome:PapAnu2.0:15:106596076:106714704:-1 gene:ENSPANG00000024642 transcript:ENSPANT00000024231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYKSEVVYFDGQS
ALLYKLDKKPLKPVRDVISLKFKAIQSNGILLHREGQHGNHITLELIKGKLVFFLNSGNA
KLPTTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGESSYLDLNFEI
SFGGVPTPGRARAFTRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNVSFSCPQPQTV
PVTFLSSRSYLALPANSGEDKVSITFQFRTWNRAGHLLFGELQRGSGSFVLFLKDGKLKL
SLFQPGQSPRNVTAGAGLNDGQWHSVSLSAKWSHMNVVVDDDTAIQPLVAALIDSGDTYY
FGGCLDNSSGSGCKSLVGGFQGSTCQVIVSLGRTLMVDPVITSCGVILRMLFFHINLVLF
SFRCLPSYCEHGGACSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGNPSGLYYI
DADGSGPLGPFLVYCNMTADAAWTVVRHGGPDAVTVRGAPSGHPRSAVSFAYAAGAGQLR
AAVSLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTYWGGSLPDAQKCTCGLE
GNCIDSQYYCNCDAGRNEWASDTIVLSQKEHLPVTQIVMMDAGQPHSEAAYTLGPLLCHG
DKSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFIRIELRAP
TEVTFSFDVGNGPCEVTVQSPTPFNDNRWHHVRAERNVKGASLQVDQLPQKMQPAPADGH
VRLQLNSQLFIGGTAARQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAGHCSTYGH
LCRNGGRCREKRRGVACDCAFSAYDGPFCSNEISAYFQTGSSMTYHFQEHYTLSENSSSL
VSSLHRDVTLTREMITLSFRTTQTPSLLLYVSSFYEEYLSVILANNGSLQIRYKLDRHQN
PDAFAFDFKNMADGQLHQVKINREDAVVVVEVNQSAKKQVILSSGTEFNAVKSLILGKVL
EAAGADPDTRRAAASGFTGCLSAVRFGRAAPLKAALRPSGPSRVTVRGHVAPVTRCAAGA
ASGSPARELAPRLAGGAGRSGPADEGEPLVNADRRDSAVIGGVIAVVIFILLCITAIAIR
IYQQRKLRKENESKVSKKEEC
Download sequence
Identical sequences ENSPANP00000019451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]