SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019454 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019454
Domain Number 1 Region: 86-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.63e-19
Family Skp1 dimerisation domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 4-68
Classification Level Classification E-value
Superfamily POZ domain 7.85e-17
Family BTB/POZ domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019454   Gene: ENSPANG00000024645   Transcript: ENSPANT00000024234
Sequence length 160
Comment pep:novel chromosome:PapAnu2.0:15:107011651:107012144:1 gene:ENSPANG00000024645 transcript:ENSPANT00000024234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAPFVMQSSDAEIFEVDRETDKQSMINKTMLEDFDDEGDDDLVPLPNVNAAIFKKVMPWC
THHKDDPPPPQGDENKERGTDHTLVWDQEFLKVDQGALFKLILAADYLDFRSLLDVTYNT
LANMIKGKTPEETDKSFNINDFMEEKEAEAHQENCGVMRS
Download sequence
Identical sequences ENSPANP00000019454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]