SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019455 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019455
Domain Number 1 Region: 230-365
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.12e-40
Family Synaptotagmin-like (S variant) 0.0000027
Further Details:      
 
Domain Number 2 Region: 82-214
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.97e-37
Family Synaptotagmin-like (S variant) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019455   Gene: ENSPANG00000024627   Transcript: ENSPANT00000024238
Sequence length 375
Comment pep:known_by_projection chromosome:PapAnu2.0:16:22830:58139:-1 gene:ENSPANG00000024627 transcript:ENSPANT00000024238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYYASASPAAASAGRRSPSDGAREDD
EDVDQLFGAYGSPEDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTITKAKGLKPMD
HNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVC
DEDKFRHNEFIGETRVPLKKLKANHTKTFSICLEKQLPVDKSEDKSLEERGRILISLKYS
SQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEF
CYEIKHGDLAKKSLEVTVWDYDIGKSNDFIGGVVLGINAKGERLKHWFDCLKNKDKRIER
WHTLTSELPGAVLSD
Download sequence
Identical sequences ENSPANP00000019455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]