SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019469 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019469
Domain Number 1 Region: 648-817
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 86-271
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-30
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 3 Region: 508-614
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000234
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 4 Region: 308-373,431-465
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000342
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019469   Gene: ENSPANG00000024616   Transcript: ENSPANT00000024252
Sequence length 864
Comment pep:known_by_projection chromosome:PapAnu2.0:16:777294:894335:-1 gene:ENSPANG00000024616 transcript:ENSPANT00000024252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRPLRYQSLAALVEDSQWPFLFLVSDFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPT
MSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLL
PMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQ
KLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEAL
LYKPIDRVTRSTLVLHACSIHAPRPGPEYSLATKLDTGQVLPGRQALPASPPAASWSPAS
LEQLQGGHGFLSQLRGSFRVHSHIFPPTLTDHLRRAKHTPPEAWKHQQYDCKWYIPLADL
VFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENE
FLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVL
TGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFV
SKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQ
IQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKR
ERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDIN
AIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFL
LEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHVTSAADIWSHDVMAQVQVLL
YYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSPANP00000019469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]