SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019484
Domain Number 1 Region: 236-279,519-598
Classification Level Classification E-value
Superfamily SET domain 6.35e-20
Family Viral histone H3 Lysine 27 Methyltransferase 0.066
Further Details:      
 
Domain Number 2 Region: 63-169
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000152
Family Tetratricopeptide repeat (TPR) 0.0069
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000169
Family MYND zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019484
Domain Number - Region: 660-726
Classification Level Classification E-value
Superfamily TPR-like 0.00171
Family Tetratricopeptide repeat (TPR) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019484   Gene: ENSPANG00000024591   Transcript: ENSPANT00000024191
Sequence length 769
Comment pep:known_by_projection chromosome:PapAnu2.0:16:1548272:1597336:-1 gene:ENSPANG00000024591 transcript:ENSPANT00000024191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPVDEWKSYLLQKWASLPKSIQLTISTAETLSDIFLHSSSLLQPEDELFLKRLSKGYL
VGKDSDAPLFYREQGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCYANRSAALFHLG
QYETCLKDISRAQTHGYPERLQPKIMLRKAECLVALGRLQEASQTIGDLERNFTATPTLA
GVPRQTLQRNLHHLKTKLQEKESPTETFPATLAKTLEDVALRGENERLSNASSSVGLCID
PLKGRYLVATKDILPGELLVKEDAFVSVLNPGELPPPHHGLDSQWDTRVTNGDLYCHRCL
KHTLATVPCDGCSYAKYCSQECLQQAWELYHRTECPLGGLLLTLGVFCHIALRLTLVVGV
EDVRKIVKKLCVKISNKDICLPESDNQVKTLNYGRGESEKNGNMVETPIPGCDANGKYDS
DYNAVFNLLPHTENHSPEHKFLCALCVSVLCRQLEAAGLQAVPTGVNSSQPTAAVTPESC
PDVTIWGVAMLRHMLQLQCNAQAITTVQHTGSKGSIVTDSRQVRLATGIFPVISLLNHSC
SPNTSVSFISTVATIRASQRIGKGQEILHCYGPHKSRMGVAERQQKLRSQYFFDCTCPAC
QTEAHRMAAGPRWKAFCCNSCRAPMQGDGVLRCGNRSCAESVVSRDHLVSRLQDLQQQVG
VAQKLLRDGELERAVQLLSRCQRDAESFLWAEHAMVGAIADGLARACAALGDWQKSATHL
QKSLRVVEVRHGPSSIEMGHELFKLAQIFFNGYRWPLSSLRVLFTSVLQ
Download sequence
Identical sequences ENSPANP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]