SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019488 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019488
Domain Number 1 Region: 440-611
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-59
Family Single strand DNA-binding domain, SSB 0.000000019
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-39
Family Single strand DNA-binding domain, SSB 0.00000149
Further Details:      
 
Domain Number 3 Region: 299-423
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-37
Family Single strand DNA-binding domain, SSB 0.000000607
Further Details:      
 
Domain Number 4 Region: 183-292
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-35
Family Single strand DNA-binding domain, SSB 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019488   Gene: ENSPANG00000024592   Transcript: ENSPANT00000024195
Sequence length 617
Comment pep:known_by_projection chromosome:PapAnu2.0:16:1597442:1659139:1 gene:ENSPANG00000024592 transcript:ENSPANT00000024195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGQLSEGAIAAIMQQGDTSIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEQERLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
GHGQPQAAPPASAGSPAASSKPQQQHGSSGAGSTVSKAYGASKTFGKAGGPSLSNTSGGT
QSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE
QVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDRHLPTVQF
DFTGIDDLESKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATL
WGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
ALDGVSISDLKSGGVGGGNTNWKTLYEVKSENLGQGDKKPDYFSSVATVVYLRKENCMYQ
ACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAI
LGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDY
REYGRRLVLSIRRSASM
Download sequence
Identical sequences ENSPANP00000019488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]