SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019493 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019493
Domain Number 1 Region: 594-818,882-1148
Classification Level Classification E-value
Superfamily TPR-like 9.1e-98
Family Tetratricopeptide repeat (TPR) 0.00013
Further Details:      
 
Domain Number 2 Region: 1245-1316,1346-1409
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000000824
Family PIN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019493   Gene: ENSPANG00000024588   Transcript: ENSPANT00000024125
Sequence length 1419
Comment pep:known_by_projection chromosome:PapAnu2.0:16:1795155:2042943:-1 gene:ENSPANG00000024588 transcript:ENSPANT00000024125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLR
NKPKIKEPSGSEEFKDEIVNDRDSSAVENGTQPVKDVCKELNNQQQNGPIDPENNRGQES
FPRTAGQEDRSLKIIKRTKKPDLQIYQPGRRLQTVSKESASRVEEEEILNQVEQLRVEED
ECRVNTAKEEVVNKPDRAETEKNPGGDRGRAAKGEKGKRIEKGEGMRKTNDDPAQGKPGS
AKRYSRSDKRRNRYRTCSTSSAGSNNSAEGAGLTDNGCRRRRQDRTKERPRLKKQVSVSS
TDSLDEDRIDEPDGLGPRRSSERKKHLERNWSGRGEGEQKSNGKENRGTLRVTFDAEAMN
KESPVGKSARDDVDRGKPDKGFSSGGKGSEKQESKNPKQELRGRGRGILILPAHTTLSVS
SAGSPESAPSGPRLLFGSGGKGPRSWGRGGTTRRLWDPNNPDQKPALKTQAPQLHFLDTD
DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYP
GPYYPGYPTPSGQYVCSPLPASTMSPEEVEQHMRNLQQQELHRLLRVADNQELQLSNLLS
RDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVK
DPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKY
ALISAQRSMICQGDIARYREQANDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEELELSPDQWRKGKK
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEKVLREFQVLLQHSPSPLGSTRMLQLMTINMFAVHNSQLKDCFS
EECRSVIQEQAAALGLAMFSLLVRRCTYLLKESAKAQLSSPEDQEDQDDIKVSSFVPDLK
ELLPSVKVWSDWMLGYPDTWNPPPTSLDLPSHVAVDVWSTLADFCNILTAVNQSEVPLYK
DPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCG
QEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGED
DIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLA
SLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFES
RDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPI
RLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG
Download sequence
Identical sequences A0A096P2B8
ENSPANP00000019493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]