SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019509 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019509
Domain Number 1 Region: 213-351
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 3.01e-30
Family Hypothetical protein c14orf129, hspc210 0.01
Further Details:      
 
Domain Number 2 Region: 1097-1214
Classification Level Classification E-value
Superfamily TPR-like 0.0000000217
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number 3 Region: 1014-1087
Classification Level Classification E-value
Superfamily TPR-like 0.000000158
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019509   Gene: ENSPANG00000024457   Transcript: ENSPANT00000024072
Sequence length 1348
Comment pep:known_by_projection chromosome:PapAnu2.0:16:2427728:2448645:-1 gene:ENSPANG00000024457 transcript:ENSPANT00000024072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIKTDELPAAAPADSARDHGSQAGGKGRPGAAELPSVMLLNGDCPESLKKEEGAAEPPR
ENGLDEADPGDETTGQEVIVIQDTGFSVKILAPGIEPFSLQVSPQEMVQEIHQVLMDRED
TCHRTCFSLHLDGNVLDHFSELRSVEGLQEGSVLRVVEEPYTVREARIHVRHVRDLLKSL
DPSDAFNGVDCNSLSFLSVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPL
QPQNRDWKPLQCLKVLTMSGWNPPPGNRKMHGDLMYLFVITAEDRQVSITASTRGFYLNQ
STAYHFNPKPASPRFLSHSLVELLNQISPAFRKNFAVLQKKRVQRHPFERIATPFQVYSW
TAPQAEHAMDCVRAEDAYTSRLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAI
FKVHSDFTAAATRGAMAVIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVRDHYKDFGGD
VAAYVAPTNDLNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILERDQEQSVIY
GSIDFGKTVVSHPRYLELLERTSRPLKILRHRVLNDRDEEVELCSSVECKGIIGNDGRHY
ILDLLRTFPPDLNFLPVPGEDLPEECARAGFPRAHRHKLCCLRQELVDAFVEHRYLLFMK
LAALQLMQQKASQLETPSSLENGGPSSLESKSEDPPGPEAGSEEEGSSASGLAKVKELAE
TIAADDGTADPRSREVIRNACKAVGSISSTAFDIRFNPDIFSPGVRFPESCQDEVRDQKQ
LLKDAAAFLLSCQIPGLVKDCVEHAVLPMDGATLAEVMRQRGINMRYLGKVLELVLRSPA
RHQLDHVYKIGIGELITRSAKHIFKTYLQGVELSGLSAAISHFLNCFLSSYPNPVAHLPA
DELVSKKRNKRRKNRPPGAADNTAWAVVTPQELWKDICQEAKNYFDFHLECETVDQAVET
YGLQKITLLREISLKTGIQVLLKEYSFDSRHKPAFTEEDVLNIFPVVKHVNPKASDAFHF
FQSGQAKVQQGFLKEGCELINEALNLFNNVYGAMHVETCACLRLLARLHYIMGDYAEALS
NQQKAVLMSERVMGIEHPNTIQEYMHLALYCFASSQLSTALSLLYRARYLMLLVFGEDHP
EMALLDNNIGLVLHGVMEYDLSLRFLENALAVSTKYHGPKALKVALSHHLVARVYESKAE
FRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIP
PLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAEVARRQQLQEASRNKDRAEEPMA
TEPAPAGAPEDLGSQPPAAKDPSPSVQG
Download sequence
Identical sequences ENSPANP00000019509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]