SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019516 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019516
Domain Number 1 Region: 1250-1457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-45
Family Laminin G-like module 0.00023
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily TIMP-like 1.02e-38
Family The laminin-binding domain of agrin 0.00000539
Further Details:      
 
Domain Number 3 Region: 1749-1772,1816-1972
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-38
Family Laminin G-like module 0.000000765
Further Details:      
 
Domain Number 4 Region: 1508-1723
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-29
Family Laminin G-like module 0.00077
Further Details:      
 
Domain Number 5 Region: 402-469
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.77e-17
Family Ovomucoid domain III-like 0.0093
Further Details:      
 
Domain Number 6 Region: 485-534
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000749
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 7 Region: 819-888
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000804
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 8 Region: 1065-1143
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000109
Family SEA domain 0.0031
Further Details:      
 
Domain Number 9 Region: 128-176
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000166
Family Ovomucoid domain III-like 0.0048
Further Details:      
 
Domain Number 10 Region: 617-668
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0037
Further Details:      
 
Domain Number 11 Region: 333-395
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000596
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 12 Region: 711-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000137
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 13 Region: 275-323
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 14 Region: 182-252
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000471
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 15 Region: 543-583
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000166
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 16 Region: 765-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1450-1485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019516   Gene: ENSPANG00000024356   Transcript: ENSPANT00000024024
Sequence length 1975
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684932.1:183073:216212:1 gene:ENSPANG00000024356 transcript:ENSPANT00000024024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRVWRYLKGKELVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWP
AHKNELMLNSSLMRITLRNLEEVEFCVEDKPGIHFTPVPPTPPDACRGMLCGFGAVCEPN
AEGPGRASCVCKKGPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRD
PCSNVTCSFGSTCARSADGLTASCLCPATCRDAPEGTVCGSDGADYPGECQLLRRACARQ
ENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARRAPVCGDDGVTYEN
DCVMGRSGAARGLLLQKVRSGQCQSRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYR
PVCAQDGHTYDSDCWRQQAECQQQRAIPSKHQGPCGQAPSPCLGVQCAFGATCAVKNGQA
ACECRQACSSLYDPVCGSDGITYGSTCELEATACTLGREIRVARKGPCDPCGQCRFGALC
EAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASTGPCETCGDAV
CAFGAVCSAGRSDGVTYGSACELREAACRQQTQIEEARAGPCEQAECGSGGSGSGEDGDC
EQELCRQRGGIWDEDSEDGPCVCDFSCQSVLGSPVCGSDGVTYSTECELKKARCESRQEL
SVAAQGACRGPTFAPLLPVAPSHCAQMPYGCCQDNITAARGVGLAGCPSACQCNPHGSYG
GTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQM
TGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGALCVEESGSAHCV
CPMLTCPEANVTKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSA
SVTVTSPGLLPSQALPTPPGAPPPAPSSTAHSQTTPLHSSQPRTTASIPRTTVWPMLTVP
PTAPSPAPSLVASAFGESGSADGSGDEELSGDQEASGGGSGGLEPFEGSSVATPGPPIER
ASCYNSPLGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELF
GETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRAPDVARA
LLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFFTGVTSGAIAAVATARATTASRLPSS
AVTPRTLHPSHTSQPVAKTTAAPTTQQPPKPCDSQPCFHGGTCQHQVSGGGFTCSCPAGR
GGATCEKALGAPVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFL
ALALLDGRVQLRFDTGSGPAVLTSAVPVEPGRWHRLELSRHWRRGTLSVDGETPVLGESP
SGTDGLNLDTDLFVGGVPEDQAAVALERTFVGTGLRGCIRLLDVNNQLLELGIGPGAATR
GSGVGECGSHPCLPNPCRGGAPCQALEAGRFHCQCPPGRVGPTCTDEKSPCQPNPCHGAA
PCRVLPEGGAQCECPLGRGGTLCQTASGQDGSGPFVADFNGFSHLELRGLHTFARDLGEK
MALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALQDRRLEFRYDLGKGAAVIRSKEPVTL
GAWTRVSLERNGRKGAMRVGDGPRVLGESPPHPLFGGQKSRKVPHTVLNLKEPLYVGGAP
DFSKLARAAAVSSGFNGAIQLVSLGGRQLLTPEHVLRQVDVTSFADHPCTRASGHPCLNG
ASCVPREAAYVCLCPGGFSGPHCENGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANE
IPVPETLESGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQL
SYNLGSQPVVLRSTVLVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGA
LWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGQRPLHLLEDAITKPELRPCPAP
Download sequence
Identical sequences ENSPANP00000019516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]