SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019518 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019518
Domain Number 1 Region: 1219-1426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.05e-45
Family Laminin G-like module 0.00023
Further Details:      
 
Domain Number 2 Region: 1709-1915
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-39
Family Laminin G-like module 0.000000416
Further Details:      
 
Domain Number 3 Region: 1477-1684
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-31
Family Laminin G-like module 0.00053
Further Details:      
 
Domain Number 4 Region: 336-403
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.63e-17
Family Ovomucoid domain III-like 0.0093
Further Details:      
 
Domain Number 5 Region: 419-468
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000735
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 6 Region: 769-838
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000776
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 7 Region: 1015-1093
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000105
Family SEA domain 0.0031
Further Details:      
 
Domain Number 8 Region: 62-110
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.0048
Further Details:      
 
Domain Number 9 Region: 484-533
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000128
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 10 Region: 567-618
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000137
Family Ovomucoid domain III-like 0.0037
Further Details:      
 
Domain Number 11 Region: 267-329
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000582
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 12 Region: 661-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 13 Region: 209-257
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 14 Region: 116-186
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000457
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 15 Region: 715-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1419-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019518
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily TIMP-like 0.0149
Family The laminin-binding domain of agrin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019518   Gene: ENSPANG00000024356   Transcript: ENSPANT00000023947
Sequence length 1917
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684932.1:183271:216212:1 gene:ENSPANG00000024356 transcript:ENSPANT00000023947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSSLMRITLRNLEEVEFCVEDKPGIHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGR
ASCVCKKGPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVT
CSFGSTCARSADGLTASCLCPATCRDAPEGTVCGSDGADYPGECQLLRRACARQENVFKK
FDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARRAPVCGDDGVTYENDCVMGR
SGAARGLLLQKVRSGQCQSRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQD
GHTYDSDCWRQQAECQQQRAIPSKHQGPCGQAPSPCLGVQCAFGATCAVKNGQAACECRQ
ACSSLYDPVCGSDGITYGSTCELEATACTLGREIRVARKGPCDPCGQCRFGALCEAETGR
CVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASTGPCETCGDAVCAFGAV
CSAGQCVCPRCEHPPPSPVCGSDGVTYGSACELREAACRQQTQIEEARAGPCEQAECGSG
GSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVLGSPVCGSDGVTYSTECELK
KARCESRQELSVAAQGACRGPTFAPLLPVAPSHCAQMPYGCCQDNITAARGVGLAGCPSA
CQCNPHGSYGGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQ
GAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGALC
VEESGSAHCVCPMLTCPEANVTKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEA
VAPSTHPTSASVTVTSPGLLPSQALPTPPGAPPPAPSSTAHSQTTPLHSSQPRTTASIPR
TTVWPMLTVPPTAPSPAPSLVASAFGESGSADGSGDEELSGDQEASGGGSGGLEPFEGSS
VATPGPPIERASCYNSPLGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTP
EMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTT
AFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFFTGVTSGAIAAVATAR
ATTASRLPSSAVTPRTLHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPLAPQQPPKP
CDSQPCFHGGTCQHQVSGGGFTCSCPAGRGGATCEKALGAPVPAFEGRSFLAFPTLRAYH
TLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPG
RWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFV
GTGLRGCIRLLDVNNQLLELGIGPGAATRGSGVGECGSHPCLPNPCRGGAPCQALEAGRF
HCQCPPGRVGPTCTDEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRGGTLCQTASGQDG
SGPFVADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVS
LALQDRRLEFRYDLGKGAAVIRSKEPVTLGAWTRVSLERNGRKGAMRVGDGPRVLGESPK
SRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFNGAIQLVSLGGRQLLTPEHVLRQV
DVTSFADHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCENGLVEKSAGDVDTLA
FDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHL
QLSYNLGSQPVVLRSTVLVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTD
GALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGQRPLHLLEDAITKPELRPCPAP
Download sequence
Identical sequences ENSPANP00000019518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]