SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019527 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019527
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-35
Family APC10-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1820-1880
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000565
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1778-1829
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 93-159
Classification Level Classification E-value
Superfamily EF-hand 0.00000187
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019527
Domain Number - Region: 1120-1193
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00406
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number - Region: 2707-2796
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019527   Gene: ENSPANG00000024368   Transcript: ENSPANT00000023861
Sequence length 2962
Comment pep:known_by_projection chromosome:PapAnu2.0:16:3667017:3805837:-1 gene:ENSPANG00000024368 transcript:ENSPANT00000023861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAAAAGGEGWGPHQDWAAVSGTTPGPGLAAPALPPAAALLEPARLREAA
AALLPTPPCESLVSRHRGALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLD
AHSSMILRFLHRNRLSSAVMPYPMLEHCKNMCTMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANVSQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALRHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTITDHLDTQYDASSLILSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESSFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFCAEEHFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSISGYLRPARAEAEQSVTCAHCR
KDTEESVCGATLLLRTLQFTQQLAHDLVQQKESGLKYKSFLDFTGLDLQIFWNFYSKLKQ
NPREECISAQTLLLQLLQSCFSVLQGDVLAASEEEKPPIQSPKGVEAAKELYTHLCDVVD
RVDGDSVPMEILKQEVRNTLLNGAAIFFPNRQTRRNHLFTMMKNVTEQEHKQSLQLTFRS
LCTYFSDKDPGGLLLLPEKNDLAKMNISEVLAVMDTLLSVAARECELLMLSGAPGEVGSV
LFSLFWSVQGSLLSWCYLQLKSTDSGAKDLAVDLIEKYVGQFLASMRVILESLLSQYSGK
TIVERLCNSVFSMAARQLVIFLLDFCPLDIPHCVLLREFSVLTELLKKLCSGPEGGLRKL
DVETWQQEQPVVLHTWTKESAHNYENNCHEASVFVSPGATYFEVEFDDRCETEKRYDYLE
FTDARGRKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSHNEWGYKFTVTAYGLPDVA
VSWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNMAIPQAKMALVLSSPLWKPVFRHQIC
PELELEASWPTHPHQNSKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACR
KQAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSDEFAQVYSLAD
GIRIWMLEMKQKSLMSLGNEAEEEHRSEATEANPESLAKECIEKSLLLLKFLPTGICSKE
SCDKLETADETNHLQPLDKRQRTSSVVEEHFQASVSPTEAATPATGDRSPGLDTQPKLPS
SSGLPAADVSPATAEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARLVPTVKEKYPVLKD
VMDFIKDQSLSHRSVVKVLSLRKAQAQSILDVLRITQYCAESLGQPHCFHPPFILFLLEL
LTCQKDFTNYFGHLEGCGADLHKEIRDTYYQLVLFLVKAVKGFSSLNDRSLLPALSCVQT
ALLHLLDMGWEPSDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEW
MDECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQ
CSDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCY
AAKKYSYGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHLTSAEDV
DGEKLDPQTRSSAATLRSQCMQLVGDCLMKAHQGKGLKALALLGILPDGDSTPEDQALPA
TAPTQASEEQLEKKTVQGAELSEAGNGKRAVHEEVRPADFKQRSKADKGVSLTKDPSCQT
QISDSPADASTPTGLPDAEDSEASSQKPREEKAVTPSPEQVFAECSQKRILGLLAAMLPP
LKSGPTVPLVDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPAEVDAAVIKV
LSAKHNLFAAGDSTIVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWR
DVIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHF
TEKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECGDSQAQLSQYSQHFAFIASHLLQTSMD
SHCPEAVEATWVLSLALKGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWL
LRDLEILSIMLYSSKKEMNALAEHGDLELDERGDREEEVERPVSSPGDPEQKKLDPLEGL
DEPTRICFLMAHDALNAPLHILRAIYELQMKKTDSFFLEVQKRFDGDELTTDERIRSLAQ
RWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSY
AKQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVLYARHVLASLLAEWPSHVPVSED
ILELSGPAHMTYILDMFMQLEEKHEWEKILQKVLQGCREDMLGTMALAACQFMEEPGMEV
QVRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDFQQDRHSFS
GSQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVV
PHLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCCGHSDLCDLALLKPLWQLFTHME
YSLFEDVTQPGILLPLHRALTELFFVTENRAQELGVLQDYLLALTTDDHLLRCAAQALQN
IAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences A0A096P2F2
ENSPANP00000019527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]