SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019529 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019529
Domain Number 1 Region: 728-1080
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.1e-53
Family Ankyrin repeat 0.000045
Further Details:      
 
Domain Number 2 Region: 449-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.52e-46
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 222-410,441-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.33e-44
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 4 Region: 48-158
Classification Level Classification E-value
Superfamily POZ domain 1.26e-19
Family BTB/POZ domain 0.0075
Further Details:      
 
Domain Number 5 Region: 1105-1164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.69e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019529   Gene: ENSPANG00000024354   Transcript: ENSPANT00000023863
Sequence length 1170
Comment pep:known_by_projection chromosome:PapAnu2.0:16:3829908:3904583:-1 gene:ENSPANG00000024354 transcript:ENSPANT00000023863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLAEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCTLLAAQANKESSSESFISRLLAIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLPNLSSTKELDLSADANPEVTMTMLR
WIYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNA
STLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLI
EMDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQR
GDLFAATFLIKNGALVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGAN
PNMQDSKGRTPLHVSIMARNEHVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQS
VNPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLAT
NSAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLAD
NIYLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWT
GMHTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINLKTRDGETAL
QLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANSLEDIASTLVRHGCDATCWGP
GPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGTNGEGEEEARDGQTPLHLAAS
WGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLT
PFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNS
RVQDASKLTPLHLAVQAGSEMIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLL
ENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKE
NAAAIFDLFLECMPEYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVN
IFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTAKFGVTTRKHHCRHCGRLLCHKCST
KEIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences ENSPANP00000019529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]