SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019550 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019550
Domain Number 1 Region: 24-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-82
Family Protein kinases, catalytic subunit 0.0000012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019550
Domain Number - Region: 366-523
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.023
Family BAR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019550   Gene: ENSPANG00000024332   Transcript: ENSPANT00000023578
Sequence length 1361
Comment pep:known_by_projection chromosome:PapAnu2.0:16:4520106:4588593:1 gene:ENSPANG00000024332 transcript:ENSPANT00000023578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQVLRREEERRQAEREQEYIRHRLEEEQRQLEILQQQLLQEQALLLEY
KRKQLEEQRQSERLQRQLQQEHAYLKSLQQQQQQQQLQKQQQQQLLPGDRKPLYHYGRGM
NPADKPAWAREVEERTRMNKQQNSPLAKSKPSSTGPEPSIPQASPGPAGPLSQTPPMQRP
VEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAIPAPTATPS
ARGAVIRQNSDPTSEGPGPSPNPPAWVRPDNEAPPKVPQRTSSIATALNTSGAGGSRPAQ
AVRARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVL
PASHGHLPQAGSLERNRVGASSKLDSSPVLSPGDKAKPDDHRSRPGRPADFVLLKERTLD
EAPRPPKKAMDYSSSSEEVESSEDDEEEGEGGPSEGSRDTPGGRSDGDTDSVSTMVVHDV
EEITGTQPPYGGGTMVVQRTPEEERNLLHADSNGYTNLPDVVQPSHSPTENSKGQSPPSK
DGSSDYQSRGLVKAPGKSSFTMFVDLGIYQPGGSGDTIPITALVGGEGTRLDQLQYDVRK
GSVVNVNPTNTRAHSETPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKV
YGLIGRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVG
DMEGCGHYRVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTV
EEGQRLKVIYGSSAGFHAVDVDSGNSYDIYIPVHIQSQITPHAIIFLPNTDGMEMLLCYE
DEGVYVNTYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHK
RAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLNRNCIMNW
Download sequence
Identical sequences ENSPANP00000019550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]