SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019553 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019553
Domain Number 1 Region: 80-207,241-305
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 9.02e-51
Family Apolipoprotein A-I 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019553   Gene: ENSPANG00000024325   Transcript: ENSPANT00000023574
Sequence length 317
Comment pep:known_by_projection scaffold:PapAnu2.0:JH682906.1:88485:97395:-1 gene:ENSPANG00000024325 transcript:ENSPANT00000023574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLWAALLVTFLAGCQAKVEQPVEPETEPELRQQAEWQSGQPWELALGRFWDYLRWVQT
LSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQA
RLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLAVY
QAGAREGAERGVSAIRERLGPLVEQGRVRAATVGSLASQPLQERAQALGERLRARMEEMG
SRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEK
VQAAVGASTAPVPSDNH
Download sequence
Identical sequences P05770 P0DKY2
ENSPANP00000019553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]