SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019586 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019586
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.29e-29
Family Txnl5-like 0.000000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019586   Gene: ENSPANG00000024256   Transcript: ENSPANT00000023395
Sequence length 123
Comment pep:known_by_projection chromosome:PapAnu2.0:16:6295228:6297734:1 gene:ENSPANG00000024256 transcript:ENSPANT00000023395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARYEEVSVSGFEEFHRAVEEHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A096P2L1 A0A0D9RJ64 A0A1D5RCZ3 A0A2K5KY98 A0A2K5YRJ5 A0A2K6ARL0 A0A2K6K295 A0A2K6QU65 G7PTE0
ENSPANP00000019586 NP_001253357.1.72884 XP_005582722.1.63531 XP_010376190.1.97406 XP_011724635.1.29376 XP_011850041.1.47321 XP_017706021.1.44346 ENSMMUP00000005049 9544.ENSMMUP00000005049 ENSMMUP00000005049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]