SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019606 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019606
Domain Number 1 Region: 332-392
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000119
Family PHD domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019606   Gene: ENSPANG00000024211   Transcript: ENSPANT00000023340
Sequence length 403
Comment pep:known_by_projection chromosome:PapAnu2.0:16:6905518:6910466:-1 gene:ENSPANG00000024211 transcript:ENSPANT00000023340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPAS
GSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQ
APDSATLLEKMKLKDSLFDLDGPKVASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPRK
KDRKNRKLGPGAGAGFGVLRRPRPTPGDGEKRSRIKKSKKRKLKKAERGDRLPPPGPPQA
PPSDTDSEEEEEEEEEEEEEEMATVVGGEAPAPVLPTPPEAPRPPATVHPEGVPPTDSES
KEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCG
TWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGPPKSGEP
Download sequence
Identical sequences A0A096P2N1 A0A0D9RHL8 A0A2K5M138 A0A2K5V0B7 A0A2K5YIJ7 A0A2K6DW44 F7D0J7
ENSPANP00000019606 ENSMMUP00000013821 XP_001106748.1.72884 XP_005582773.1.63531 XP_008008291.1.81039 XP_011725317.1.29376 XP_011850004.1.47321 XP_011908851.1.92194 9544.ENSMMUP00000035322 ENSMMUP00000035322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]