SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019607 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019607
Domain Number 1 Region: 317-377
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000111
Family PHD domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019607   Gene: ENSPANG00000024211   Transcript: ENSPANT00000023341
Sequence length 388
Comment pep:known_by_projection chromosome:PapAnu2.0:16:6905518:6910466:-1 gene:ENSPANG00000024211 transcript:ENSPANT00000023341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPAS
GSSSPLRGESAADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQ
APDSATLLEKMKLKDSLFDLDGPKVASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPRK
KDRKNRKLGPGAGAGFGVLRRPRPTPGDGEKRSRIKKSKKRKLKKAERGDRLPPPGPPQA
PPSDTDLATVVGGEAPAPVLPTPPEAPRPPATVHPEGVPPTDSESKEVGSTETSQDGDAS
SSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAGRPMIECSLCGTWIHLSCAKIKKTNV
PDFFYCQKCKELRPEARRLGGPPKSGEP
Download sequence
Identical sequences ENSPANP00000019607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]