SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019646 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019646
Domain Number 1 Region: 1193-1285,1330-1534
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.04e-44
Family Type II Proline 3-hydroxylase (proline oxidase) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019646
Domain Number - Region: 96-152
Classification Level Classification E-value
Superfamily TPR-like 0.00247
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 769-1171
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0259
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019646   Gene: ENSPANG00000024053   Transcript: ENSPANT00000023092
Sequence length 1677
Comment pep:known_by_projection chromosome:PapAnu2.0:16:7543928:7552527:1 gene:ENSPANG00000024053 transcript:ENSPANT00000023092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLAAPL
PPSHGSSSGHPNKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE
HDSEEATRCYHSALRYGGSFAELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLL
HLEHKRNYGAKRGGPPVKRAAEPPVVQPVPPAALSGPSGEEGLSPGGKRRRGCNSEQTGL
PPGLPLPPPPLPPPPPPPPPLPGLATSPPFQLTKPGLWSTLHGDAWGPERKGSAPPERQE
QRHSLPHPYPYPAPAYTTHPPGHRLVPAAPPGPGPRPPGAESHGCLPATRPPGSDLRESR
VQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTTSSSSSSSNTGLRGVEPNPGIPGADH
YQTPALEVSHQGRLGPSVHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPPPPPA
WLKGPACRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDSHTPP
TPPAPTTSSSNSNNGSHSSSPAGPVSFPPPPYLARSIDSLPRPPSPAQNPQDPPLVPLTL
ALPPAPPSSCHQNTSGSFRRPESPRPRVSFPKTPEVGPGPPPGPLSKAPQPVPPGVGELP
ARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQHEAGVAPPPP
LKEPFASLQPPFPTDTAPTTTAPAAAVTTTTTTTTATQEEEKKPPPALPPPPPLAKFPPP
PQAQPPPPPPANPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPGPPSGATA
PPPTSVAPSAQGSPQPPASSSSQFSTSGGPWARERRAGEEPVPGPTTPTQPPPPLPLPPA
RSESEVLEEISRACETLVERVGRSAADPADPVDTAEPADSGTERLLPPAQAKEEGGGVVA
ASVTGSCKRRQKEHQKEHRRHRRACKDSVGRRPREGRAKAKTKAPKEKSRRVLGNLDLQS
EEIQGREKSRPDLGGASKVKPPTAPAPPPAPAPSAQPTLPSASVPGKKAREEAPGPPGVS
RADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAADVVRA
SKNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPVLLQFC
TDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLTGTRQI
WPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSTPDPKNHHI
IKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGS
RTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILDDLY
ASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEV
KNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKKIAYQG
RVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLEQYRTE
ELAQAYDAFTLVRARRARGQRRRALGQAAGTGFGSPAAPFPEPPPAFSPQAPASTSR
Download sequence
Identical sequences A0A096P2S1
ENSPANP00000019646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]