SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019650 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019650
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.34e-40
Family Single strand DNA-binding domain, SSB 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019650   Gene: ENSPANG00000023936   Transcript: ENSPANT00000023128
Sequence length 121
Comment pep:novel scaffold:PapAnu2.0:JH684925.1:70595:71040:-1 gene:ENSPANG00000023936 transcript:ENSPANT00000023128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMMELPRSRINASMLAQFTDKPVCFVERLEKIHPTGKMFILPDGEGKNGTIELMEPLD
EEISGIMEVVGKVTTKATILCTSYVQFKEDNHPFDLRLYNEAVEIIHEFPQFYPLGIIQQ
D
Download sequence
Identical sequences ENSPANP00000019650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]