SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019686 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019686
Domain Number 1 Region: 394-527
Classification Level Classification E-value
Superfamily TIMP-like 1.04e-37
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 210-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000107
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 3 Region: 267-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 330-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 20-100
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000992
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019686
Domain Number - Region: 80-151
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0575
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019686   Gene: ENSPANG00000023775   Transcript: ENSPANT00000022953
Sequence length 530
Comment pep:known_by_projection chromosome:PapAnu2.0:16:8693947:8919159:1 gene:ENSPANG00000023775 transcript:ENSPANT00000022953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RECVRPGRGQGSTPSXHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLT
LSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITK
QNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLH
TFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPEC
DRCKPFHYDRPWQRATAREANACLAACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHN
TAGRHCHYCKEGYYRDMGKPISHRKACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITC
NRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKD
YAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKK
YLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA
Download sequence
Identical sequences ENSPANP00000019686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]