SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019687 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019687
Domain Number 1 Region: 139-206
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.45e-17
Family SNARE fusion complex 0.0000705
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019687
Domain Number - Region: 6-194
Classification Level Classification E-value
Superfamily t-snare proteins 0.0863
Family t-snare proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019687   Gene: ENSPANG00000023776   Transcript: ENSPANT00000022683
Sequence length 236
Comment pep:known_by_projection chromosome:PapAnu2.0:16:8926934:9256383:-1 gene:ENSPANG00000023776 transcript:ENSPANT00000022683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKD
LLLRAVATHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGA
PNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLRTETRRVNLVDRKSTSCGMIMVILLLLVAIVVVAVWPTN
Download sequence
Identical sequences A0A096P2W2 F6XAN6 G7PTM2
9544.ENSMMUP00000012301 ENSPANP00000019687 ENSMMUP00000012301 NP_001252683.1.72884 XP_005582935.1.63531 XP_008008521.1.81039 XP_011828544.1.47321 ENSMMUP00000012301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]