SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019695 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019695
Domain Number 1 Region: 138-414
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.54e-55
Family FCH domain 0.0033
Further Details:      
 
Domain Number 2 Region: 13-49
Classification Level Classification E-value
Superfamily WW domain 0.0000000000312
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019695   Gene: ENSPANG00000023755   Transcript: ENSPANT00000022844
Sequence length 416
Comment pep:known_by_projection chromosome:PapAnu2.0:16:9585506:9702866:-1 gene:ENSPANG00000023755 transcript:ENSPANT00000022844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGS
HRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVT
FPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEF
IRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEV
EKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIK
LSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGSIRPVDMEI
Download sequence
Identical sequences A0A096P2X0 A0A0D9RCL8 A0A2K5HF18 A0A2K5LCR5 A0A2K6AFM8
XP_008008544.1.81039 XP_011788654.1.43180 XP_011828552.1.47321 XP_011828553.1.47321 XP_011906253.1.92194 ENSPANP00000019695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]