SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019704 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019704
Domain Number 1 Region: 136-297
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.85e-51
Family Glutathione peroxidase-like 0.0000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019704   Gene: ENSPANG00000023763   Transcript: ENSPANT00000022805
Sequence length 303
Comment pep:known_by_projection chromosome:PapAnu2.0:16:10333456:10353099:-1 gene:ENSPANG00000023763 transcript:ENSPANT00000022805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLVLVPGRVMRPLGGQLWRFLPRGLELWGPAEGTARVLLRQFCAQQGDVWRASGLLGY
CLGTRPLSTARPPPPPPWSEKGPRDSTRPSKPGPVSWKSLAITFAIGGALLAGMRYMKKE
KAEKLEKERQRQIGKPLLGGPFSLTTHTGEHKTDKDYLGQWLLIYFGFTHCPDVCPEELE
KMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIAKYVKEFSPKLVGLTGTREEVDQVA
RAYRVYYSPGPKDEDEDYIVDHTIIMYLVGPDGEFLDYFGQNKRKGEIAASIVAHMRPYR
KKS
Download sequence
Identical sequences A0A096P2X9
ENSPANP00000019704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]