SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019732 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019732
Domain Number 1 Region: 99-206
Classification Level Classification E-value
Superfamily TPR-like 6.03e-17
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019732
Domain Number - Region: 2-130
Classification Level Classification E-value
Superfamily TPR-like 0.00683
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019732   Gene: ENSPANG00000023712   Transcript: ENSPANT00000022472
Sequence length 234
Comment pep:known_by_projection chromosome:PapAnu2.0:16:16155542:16182610:-1 gene:ENSPANG00000023712 transcript:ENSPANT00000022472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLAFIRGQLENAEQLFKATMSYLLGGGMKQEDNAIIEISLKLASIYAAQNRQEFAIAG
YEFCISTLEEKIEREKELAEDIMSVEEKANTHLLLGMCLDACARYLLFSKQPSQAQRMYE
KALQISEEIQGERHPQTIVLMSDLATTLDAQGRFDEAYIYMQRASDLARQINHPELHMVL
SNLAAVLMHRERYTQAEEIYQEALKQAKLKKDEISVQHIREELAELSKKSRPLT
Download sequence
Identical sequences ENSPANP00000019732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]