SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019778 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019778
Domain Number 1 Region: 112-172,293-376
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 369-493
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-22
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019778   Gene: ENSPANG00000023621   Transcript: ENSPANT00000022184
Sequence length 604
Comment pep:known_by_projection chromosome:PapAnu2.0:16:19093404:19170474:-1 gene:ENSPANG00000023621 transcript:ENSPANT00000022184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQS
SLAEPVSPSKKHETTAAFLTDSLDKRLEDSGSAQLFMTHSEGIDLNNRTNSTQNHLLLSQ
EYDSAHSLHLERARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVN
TFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFL
RSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFI
RESEPEPDVKKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEK
STKL
Download sequence
Identical sequences A0A096P353 A0A2K5MCK5
ENSPANP00000019778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]