SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019840 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019840
Domain Number 1 Region: 154-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-54
Family DBL homology domain (DH-domain) 0.0000757
Further Details:      
 
Domain Number 2 Region: 381-499
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019840   Gene: ENSPANG00000023439   Transcript: ENSPANT00000021811
Sequence length 579
Comment pep:known_by_projection chromosome:PapAnu2.0:9:5613563:5658394:1 gene:ENSPANG00000023439 transcript:ENSPANT00000021811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGVAGPSADTSGPELDGRYSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLASLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIKRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVNWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAISIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRLHDPSPGQSHT
LQANDVFHKQQWFNCIRAAXXXXXXXXXXXXXXXXXGRGQQELKDTPDTARHPKSEGQSP
VWWQTERDFGVEKALCVNWSRRLFVYKCVQFCFLVRGAL
Download sequence
Identical sequences ENSPANP00000019840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]