SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019850 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019850
Domain Number 1 Region: 28-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000142
Family Complement control module/SCR domain 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019850   Gene: ENSPANG00000023429   Transcript: ENSPANT00000021852
Sequence length 263
Comment pep:known_by_projection chromosome:PapAnu2.0:9:6144877:6166062:-1 gene:ENSPANG00000023429 transcript:ENSPANT00000021852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPRVPGERVLQVETCSPSPVLCTFAGITCPPPVSVEHADIRVKSYSLYSRERYICNSGF
KRKAGTSSLTECVLNKATNIAHWTTPSLKCIRDPLLARQRPAPPFTVTTAGVTPQPESLS
PSGKEPAASSPSSNTTAATTAAIVPSSRLTPSTSPSTGTTEIGSHESSHGPSQTTAKTWE
LTASASHQPPGVYPQGHSDTTVAISASTVLLCGLSAVSLLACYIKSRQTPPPASIEMEAM
EALPVTGETSGRDEDLENCSHDL
Download sequence
Identical sequences ENSPANP00000019850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]