SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019852 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019852
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.000016
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000347
Family Complement control module/SCR domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019852   Gene: ENSPANG00000023431   Transcript: ENSPANT00000021828
Sequence length 272
Comment pep:known_by_projection chromosome:PapAnu2.0:9:6220306:6273037:-1 gene:ENSPANG00000023431 transcript:ENSPANT00000021828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMEPSQFPGEEEPQASPDGLPESETSRLVTTTDFRIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKNRRTI
Download sequence
Identical sequences A0A096P3C7
ENSPANP00000019852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]