SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019856 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019856
Domain Number 1 Region: 410-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-96
Family Protein kinases, catalytic subunit 0.0000000000156
Further Details:      
 
Domain Number 2 Region: 35-156
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.63e-23
Family PLC-like (P variant) 0.0000366
Further Details:      
 
Domain Number 3 Region: 248-318
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.57e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 176-244
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.78e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019856   Gene: ENSPANG00000023409   Transcript: ENSPANT00000021860
Sequence length 739
Comment pep:known_by_projection chromosome:PapAnu2.0:9:6628928:6711167:-1 gene:ENSPANG00000023409 transcript:ENSPANT00000021860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKHWLSRRGTPKTISFIAPKQHLSFVVFQGVTMSPFLRIGLSNFDCGSCQSCQGEAVNP
YCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTV
ELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMSEFETEGFFALHQRRG
AIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIA
KCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGM
NVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCPTKNE
ARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQMKLKIEDFILHKMLG
KGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCT
FQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKL
DNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQRYNHSVDWWSFGV
LLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGD
IRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLNEKPRLSFADRALINSMD
QNMFRNFSFMNPGMERLIS
Download sequence
Identical sequences ENSPANP00000019856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]