SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019860 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000019860
Domain Number - Region: 73-139
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0016
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 161-326
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0795
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019860   Gene: ENSPANG00000023414   Transcript: ENSPANT00000021804
Sequence length 617
Comment pep:novel scaffold:PapAnu2.0:JH685103.1:92899:103107:1 gene:ENSPANG00000023414 transcript:ENSPANT00000021804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEETRQSILAEAKKKLKEYWQRNSPGGPTGAKKNRKINGSSPETATSGGSHSPGDSATG
IDGEGPTSSAPLKDLESPSQELAAVLDSRSVKISRLNNIIKSLKQQKKQVEHQLEEEKKA
NNETQKAERELEVQIQTLNVQKGKLSTDLYHTKRSLRYFEEESKDLAGRLQQTLQCIEEL
ERALSAVPATQEEKEISFSSRSQALIEWQLEQSTQEKARLKAQLTQMKDSLKQAHLERDE
YAQHLKGERAQWQQRMRKMWQEVCTLKKEKKDDTHRVEELKRSLSKLKNQMAEPLPPEPP
AVPPEEELQHLRKELERVSAELQAHVENHQHVSLLNQTQKERLGRQEQLAEPQSGVEELN
NENKSALHLEQQVEELQEKLDEERLEASSQQSQQLNAPLNLTALPGEGDGGGHLDSEEEE
GPRPMPSVPEDLESWEAMSSFMDHREEMADLSELVEKPELPFIEYWGERCHQNVHQLLTE
AGGCAEDAAMGGGHHQAGPAQGGDEGEAAGAAGDAVTACADHNNEHSKLLTSSQNPADEP
GPGAPPPQELGAANQHSDLCEVSLTDSAETGQGEAKEGSPSDNPTAQSIVQDQQEHPALG
SNLCVPFFCWAWLRRRR
Download sequence
Identical sequences ENSPANP00000019860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]