SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019866 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019866
Domain Number 1 Region: 835-920
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-18
Family PHD domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019866
Domain Number - Region: 14-73
Classification Level Classification E-value
Superfamily Histone-fold 0.0165
Family Archaeal histone 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019866   Gene: ENSPANG00000023405   Transcript: ENSPANT00000021765
Sequence length 931
Comment pep:known_by_projection chromosome:PapAnu2.0:9:7954048:8156621:1 gene:ENSPANG00000023405 transcript:ENSPANT00000021765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PVLDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTTQSPAMVGSPIR
SPKTVSKEKKSPGRSKSPKSPKSPKVMTHIPQTPVRPETPNRTPSATVSEKISKETIQVK
QIQTPPDAGKLNNENQPKKALVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGPECTTPKASTSTNNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DREREKDKNKDKSKEKDKVKEKEKDKEAGRETKYPWKEFLKEEEADPYKFKIKELEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKE
LALPLFSPAAAARVPAMLPSLLPVLPEKLFEEKEKPKEKEKKKDKKEKKKKKEKEKEKKE
KEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVV
PAPEAKPAPSQNRPKTPPPAPAPTPGPMLVSPAPVPLPLLAQAAAGPALLPTPGPAASGA
SAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIM
TAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
Download sequence
Identical sequences A0A096P3E1
ENSPANP00000019866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]