SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019885 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019885
Domain Number 1 Region: 404-515
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 585-692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-21
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 698-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 757-819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000117
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 344-409
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 824-884
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000017
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 520-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 228-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000222
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019885   Gene: ENSPANG00000023373   Transcript: ENSPANT00000021618
Sequence length 982
Comment pep:known_by_projection chromosome:PapAnu2.0:16:22342527:22367863:-1 gene:ENSPANG00000023373 transcript:ENSPANT00000021618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLIIPGLSSEAPTMGKGQAPGIEETDGELTAAPTPEQPERGVHFVTTAPTLKLLNHHPLL
EEFLQEGLEKGDEELRPALPFQPDPPTPFTPSPLPRLANQDSRPVFTSPTPATAAVPTQP
QSKEGPWSLESEPPVLRITAPLPPGPSMAVPTLGPGERPSTTPPSRAWTPTQEGPGDMGR
PWVPEVVSQGAGIGIQGTIASSTASGDDEEVTVRTEIRLHVLCVSSCLPGPCSWNFSGPE
GSLDSPTDLSSPPDVGLDCFFYISVYPGYGVEIKVQNISLREGETVTVEGLGGPDPLPLA
NQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPHRPAYGDVTVTS
LHPGGSARFHCATGYQLKGARRLTCLNATQPFWDSKEPVCIAACGGVIRNATTGRIVSPG
FPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEY
LPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPTYPVG
TTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEP
YGRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPHSHFKLF
TSMADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGT
VVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVG
ATVQYICDQGFVLTGTSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPE
KRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICKAASLDGFYNSRSLDVA
KAPAASSTLDAAHIAAAIFLPLVAMVLLVGGVYFYFSRLQGKSSLQLPRTRPRPYNRITV
ESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences ENSPANP00000019885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]