SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019886 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019886
Domain Number 1 Region: 16-193,299-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.01e-34
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 196-299
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-25
Family D-aminoacid oxidase-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019886   Gene: ENSPANG00000023365   Transcript: ENSPANT00000021619
Sequence length 364
Comment pep:known_by_projection chromosome:PapAnu2.0:16:22430966:22446459:1 gene:ENSPANG00000023365 transcript:ENSPANT00000021619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIISLVFHFQFFLPHSRGSSHGQSRIIRKAYLEDFYTQMMHECYQIWAQLEHEAGTQL
HRQTGLLLLGMKENQELKTIQATLSRQRVEHQCLSSEELKQRFPNIRLTRGEVGLLDNSG
GVLYAYKALRALQDAVRQLGGIVHDGEKVVEINPGLLVKVKTTTRSYQAKSLVITAGPWT
NQLLRPLGIELPLQTLRINVCYWRERVPGSYGVSQAFPCFLWLGLYPHHLYGLPAGEYPG
LMKVSYHHGNHADPEERDCPTARADIRDVQIVSSFVRDHFPDLKPEPAVMESCMYTNTPD
EHFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLG
KAHL
Download sequence
Identical sequences ENSPANP00000019886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]