SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019903 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019903
Domain Number 1 Region: 135-176
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000167
Family SAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019903   Gene: ENSPANG00000023295   Transcript: ENSPANT00000021436
Sequence length 187
Comment pep:known_by_projection chromosome:PapAnu2.0:9:15007993:15026190:-1 gene:ENSPANG00000023295 transcript:ENSPANT00000021436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCASPVAVVAFCAGLWVSHPVLAQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSL
DTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLD
SQICELKYEKTLDLASVDLQKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAA
THPKTEL
Download sequence
Identical sequences A0A096P3H8
ENSPANP00000019903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]