SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019992 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019992
Domain Number 1 Region: 14-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-27
Family G proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 418-588
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.21e-25
Family G proteins 0.0092
Further Details:      
 
Domain Number 3 Region: 169-255,307-390
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000054
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019992   Gene: ENSPANG00000023084   Transcript: ENSPANT00000021035
Sequence length 662
Comment pep:known_by_projection chromosome:PapAnu2.0:16:25338125:25394242:1 gene:ENSPANG00000023084 transcript:ENSPANT00000021035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRDLCFYRIYFARVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGRLFSYVTLYIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLYVFPHDSNF
SSSCGDYKYLFLFVLLRKENQDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWI
TYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAITVTRDKKIDLQKKQTQRN
VFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDIS
ESEFLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQE
YGISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHARLRCMCTCNRCTFCI
CQNFLNSDLLQSVKNKIFTAVLNRHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLK
QR
Download sequence
Identical sequences ENSPANP00000019992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]