SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019993 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019993
Domain Number 1 Region: 159-366
Classification Level Classification E-value
Superfamily Rhomboid-like 1.14e-31
Family Rhomboid-like 0.0046
Further Details:      
 
Domain Number 2 Region: 26-102
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000157
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019993   Gene: ENSPANG00000023087   Transcript: ENSPANT00000021036
Sequence length 406
Comment pep:known_by_projection chromosome:PapAnu2.0:16:25428316:25486572:1 gene:ENSPANG00000023087 transcript:ENSPANT00000021036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEHPSPGPAVAACAEAERIEELEPEAEEQLPAAPEDHWKVLFDQFDPGNTGYISTGKFR
SLLESHSSKLDPHKREVLLALADSHADGQICYHDFISLMSNKRSNSFRQAILQGNRRLSS
KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYN
GVSLGQFVLQVTHPRYLKNSLVYHPQLRAQAWRYLTYIFMHAGIEHLGLNVVLQLLVGVP
LEMVHGATRIGLVYVAGVVAVLGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSG
MKCQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFMAHLGGVAVGITLGVVVL
RNYEQRLQDQSLWWIFVAMYTVFVLFAVFWNIFAYTLLDLKLPPPP
Download sequence
Identical sequences ENSPANP00000019993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]